Bioinformatics connects life sciences and quantitative sciences, typically involving the application of software and algorithms to solve computationally intensive questions, such as those in genomics, sequence analysis, and systems biology. Questions tagged Bioinformatics should have a direct ...

learn more… | top users | synonyms (1)

0
votes
2answers
25 views

Merge several .ab1 sequence files into a single FASTA file?

I have several .ab1 files generated from Chromas. I want to merge all of them into a single FASTA sequence file. How can I do this in an automated way? Note that I don't have Chromas installed (the ...
10
votes
2answers
900 views

Why and how does uniprot list ~150,000 proteins in the human genome?

Using organism:"Homo sapiens (Human) [9606]" as a query in uniprot returns ~146,000 proteins. I was under the impression that there were only 20-25,000 proteins in ...
-2
votes
0answers
42 views

Importance of Biodegradation pathway over other pathways

What is the importance of biodegradation pathway over other pathways? This question occured when I saw this paper: Fenner K, Gao J, Kramer S, Ellis L, Wackett L. Data-driven extraction of relative ...
1
vote
1answer
56 views

IC50 calculation [closed]

I am a computer science student and I'm in an internship at a genomics and biotechnologies research institute. My current task is to calculate the IC50 and the EC50 given a set of data as a table. ...
1
vote
1answer
43 views

How to compare two RNA transcripts?

In this paper, the cuffcompare RNA package is reported: Because of the stochastic nature of sequencing, assembly of the same transcript in two different samples may result in transfrags of ...
8
votes
6answers
416 views

Introductory literature for synthetic / systems biology?

I'm a computer engineer (MsC Computer Engineering) who's looking to switch into the field of synthetic / systems biology. I've got a comprehensive layman's understanding of evolution, genetics, ...
1
vote
0answers
43 views

Interpretation of qPCR results for low expression genes

I am attempting to validate existence of a transcript using 40 cycle qPCR. I designed primers for a unique feature of this transcript, and also designed primers for a sequence in the transcript that ...
7
votes
2answers
120 views

What are some (bioinformatic) methods to characterize potentially novel gene transcripts?

I am working with a few novel transcripts of genes- before I confirm their existence experimentally, I would like to perform some bioinformatic analysis. I have already considered coding potential, ...
0
votes
1answer
28 views

What does “each pathway define an independent genotype” mean?

In a section of this paper. However, if the question of independency is posed in the form: “Does each pathway shown define an independent genotype?,” then each of these three pathways is ...
4
votes
2answers
86 views

Do variant callers miss rare variants in reference?

Generally variant calling programs (such as GATK-UnifiedGenotyper) look for differences between reference genome and submitted sequence. However, we all know that reference genome consist rare ...
4
votes
1answer
138 views

What do “e” “-” “C” and “E” mean in this output?

I have given an input of this protein sequence: MEPVDPRLEPWKHPGSQPKTACTTCYCKKCCFHCQVCFTTKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQPRGDPTGPKE from this website along ...
3
votes
1answer
40 views

Are there journals for theoretical models of protein-protein interactions?

Are there respectable scientific journals for publishing models of protein-protein interactions obtained by docking simulations? I would also discuss the biological significance of the particular mode ...
12
votes
3answers
1k views

Databases for gene regulatory network graphs?

What databases are available for gene regulatory network graphs starting from a given gene? For example, starting from p53 gene, where can I find a gene regulatory network image that can be exported ...
0
votes
2answers
93 views

What are the programming languages important to learn for a geneticist or bioinformatician? [closed]

I am interested in learning more about both genomics and bioinformatics, with emphasis on genomics. I was told after taking an introductory course of genomics that the programming language "R" and ...
15
votes
0answers
446 views

Additive genetic variance components from LMER in R

I've set up some dummy data in R which makes 40 genetically related lines, they are all siblings within a line so are genetically related by a factor of ½ thus additive genetic variance should be ...
2
votes
1answer
41 views

Extract protein sequences from a GBK(GenBank) file without scripting [closed]

How to extract protein sequences from a GBK(GenBank) file without scripting? I know that writting a script using BioPerl or Biopython can do this, but it is not elegant and daunting to beginners and ...
1
vote
1answer
40 views

Hodgin-Huxley model for a single neuron - continuation

As continuation to This question I have posted. Another set of questions is given for the same model : This time it is also given that for $t<0$ the membrane potential is $u_0$, and at $t=0$ it ...
12
votes
2answers
104 views

How can we verify predictions of protein folding in silico?

Currently, there is a lot of research focused on solving the folding patterns of proteins using computers (Folding@Home, https://fold.it/portal/, etc.). The question that I have is: How do you know ...
0
votes
1answer
30 views

How reliable is SwissProt topology?

I am using TOPO_DOM annotations from uniprot databases to characterise the orientation of transmembrane features. Is SwissProt topology experimentally validated, ...
13
votes
2answers
10k views

What is the difference between local and global sequence alignments?

Obviously there are a bunch of different alignment tools out there, and I don't want to get bogged down in the maths behind them as this differs from software version to version. I am aware that ...
0
votes
1answer
34 views

What is the difference between options protein and replication in the NCBI database?

After checking the NCBI help page, I am still unclear about the difference between protein and replication interactions for HIV. ...
4
votes
1answer
27 views

Which hydrophobicity scales are best for detecting transmembrane regions, and why?

There are many hydrophobicity scales for protein analysis. Broadly, I gather the differences between them are from the experimental method to acquire the data and the normalisation (or lack thereof) ...
2
votes
1answer
40 views

Design arbitrary degenerate primers (with non-binding criteria)

I would like to design a number of arbitrary degenerate primers (primers with variable bases, e.g. NGATWGCTSATNGC) for a TAIL-PCR. I would like to be able to ...
0
votes
0answers
27 views

Cut-off values for LD, LOD and D-prime as algorithmic input

I created an algorithm to generate SNPs for random people of different descents - based on HapMap data. While this works good, there is something else I want to take into consideration. So if a SNP ...
3
votes
0answers
48 views

Efficient algorithm to calculate various population divergence statistics

Intro and description of the data I am simulating the evolution of very long DNA sequences. The model works well, is performant and will output data in the following kind of fasta format ...
9
votes
0answers
109 views

Biopython - Big Discrepancy Calculating RNA melting Temperature over Literature

I experience big discrepancies when calculating melting temperature of RNA 7-mers with Biopython over values generated by a popular algorithm. I tried the nearest neighbour algorithm with RNA and ...
0
votes
2answers
76 views

Programmatic way to differentiate homodimers from heterodimers?

For pdb files is there a simple programmatic way to determine if the file is made up of homodimers or heterodimers. I have many files so an online tool or some ...
1
vote
2answers
54 views

What's read depth in VCF?

There is an attribute defined as DP (Total Depth) in VCF file format. For example, http://www.1000genomes.org/node/101. What does this attribute mean? If I get a value of like DP=128. How can be that ...
3
votes
2answers
37 views

Deciding a reasonable threshold for copy number variation in a CNV (SNP array) TCGA dataset

Is there a methodology to select a reasonable threshold for copy number variation in a CNV (SNP array) TCGA dataset, to define when there is a significative alteration? Can I download CNV data for ...
-1
votes
1answer
45 views

What is enrichment? [closed]

Could someone please clarify, in layman's terms, what enrichment means? I'm currently looking at MACS and peak calling. Repeated mentions of "enriched" or "enrichment". Thanks.
-1
votes
3answers
45 views

Patterns/Motifs Repository [closed]

I am new to this area. I am a researcher working on fast pattern searching in general scenarios (e.g., regex in string matching). I am curious about the "regular expression (regex)" (pattern/motif) ...
1
vote
1answer
72 views

best book for a comprehensive introduction to biology for a computer science graduate interested in undertaking research in bioinformatics [closed]

I have a postgraduate degree in computer science, and I wish to undertake research in bioinformatics. I had chemistry but no biology in high school. I have read bioinformatics books like "biological ...
7
votes
1answer
92 views

Is using Hidden Markov Models to find homologues sensible in abstract, short sequences?

HMM alignment tools like hhpred excel at finding subtle homologues of folded proteins that simpler scoring techniques (such those used in BLAST algorithms) would miss. I am only looking at a small ...
3
votes
1answer
142 views

mFOLD prediction result interpretation

I am trying to predict the secondary structure of certain predicted pre-miRNAs through mFOLD which is the generally accepted technique for structure prediction in most studies. I am finding it hard to ...
1
vote
1answer
54 views

how to reconcile PDB structures' sequences via Uniprot references?

I’m trying to reconcile structures in PDB entries with their sequences as reported in their chemList.polymer.dbref entries. E.g.: considering structures for HIV ...
4
votes
2answers
194 views

How can I fetch nucleotide sequences based on ENA accession numbers and positions?

I have a list of ENA accession numbers and a start and end position in each sequence. In the end I want to align all those sequences, but first I have to fetch them and the list is too long to do that ...
1
vote
2answers
56 views

Introductory book in genetics? [duplicate]

I am working in the field of neuroscience with a background in computer science. I try to find new ways of analyzing brain imaging data (mostly MRI, EEG, MEG, fMRI) with modern machine learning ...
19
votes
3answers
1k views

120-year-old gene regulation problem independently solved by a computer. How?

My Background: I'm a mathematics graduate student with a physics background. I have a very little biology knowledge and a little knowledge of machine learning and statistics. Topic: I recently ...
2
votes
1answer
54 views

GATK workflow for Cancer

I am just starting to learn to use bioinformatics tools. My university has a limited and expensive bioinformatics team, so I'm mostly on my own except for big questions. I am planning to use GATK to ...
2
votes
1answer
44 views

How do I find the number of child terms associated with a specific GO term?

I am trying to figure out how to find the number of child terms associated with a specific Gene Ontology (GO) term using QuickGO, without just counting the amount of terms in a list. For example when ...
5
votes
1answer
134 views

Sequence evolution simulation tool

I'm looking for a tool to simulate sequence evolution given a specific mutation model and birth-death model. I'm aware of tools and packages like INDELible, Seq-Gen and PhyloSim, but they simulate ...
3
votes
4answers
101 views

Identifying the origin of replication of an unannotated *E. coli* plasmid

I have attempted a few searches for a list of origins of replication for plasmids in E. coli, but I was only able to find a list of origins, but not their individual sequences. The available plasmid ...
1
vote
0answers
27 views

Load specific sequences in with BioSeqIO [closed]

I am trying to load a multifasta file with Perl using my $in = Bio::SeqIO->new( -file => $entrance) and then I loop trhough the file looking for id i ...
8
votes
4answers
73 views

Are there constraints on where intron/exon boundaries occur with respect to the triplet codons of the reading frame?

I did a quick search (here and elsewhere) and couldn't find anything on this subject. If all introns in a given primary transcript were spliced out in the same way, then this wouldn't matter. But ...
0
votes
0answers
29 views

Primer heterodimer problem

I design my primers in Primer3PLUS and analyze them in Oligoanalyzer3.1, A big problem that I have this is that I got very nice output in NCBI-Primer BLAST for their specificity but a very negative ΔG ...
2
votes
2answers
413 views

MOL2 to PDBQT conversion via OpenBabel and MGLTools removes hydrogen atoms

I am trying to convert a MOL2 file (includes partial charges and hydrogen atoms) into a PDBQT file for re-scoring in AutoDock Vina. However, both approaches that I tried don't keep the hydrogen atoms ...
1
vote
1answer
25 views

Affymetrix SNP data, how to filter out rows based on rsid [closed]

This is my first time on stackexchange. I am new to bioinformatics, and I have some new SNP data from an Affymetrix Axiom array. I have the genotypes exported into a giant tab-delimited table txt ...
5
votes
2answers
59 views

What ways are there to determine how big genera are?

I want to look at genera as a whole, across the animal kingdom to determine the range of sizes of genera. I have examined species richness and genetic diversity (pairwise distance from sequence data ...
6
votes
1answer
40 views

Comparison of gene expression time series in vitro and in vivo

I have to analyse two datasets consisting of time-series measurements of gene expression. One set are in vivo data from the expression profiles obtained between a few days before birth to several days ...
13
votes
2answers
400 views

Looking for a cancer drug target database to guide sequencing of patient tumor DNA

I have a question I would like to pose to the community. I have recently received access to a bench-top ion torrent DNA sequencer. Our idea is to use this machine to sequence the DNA from patient’s ...