Questions pertaining to organized collections of biological data.

learn more… | top users | synonyms

9
votes
2answers
116 views

Where can I find historical data on world-wide ecology parameters?

I hope this is the right StackExchange forum for such a question. I'm looking for large data sets on world-wide ecology parameters, such as annual temperatures by latitude, annual rainfall, CO₂ and ...
6
votes
1answer
71 views

Database of Geographic Range of Species

Is there a database of organisms which would contain their queriable geographic location? I would need to perform a rather simple query, such as ...
6
votes
1answer
57 views

How to search for organisms by criteria such as growth substrate and overflow metabolites?

I'm looking for a database or a systematic way to search for organisms which meet certain criteria. My criteria descending importance are: growth substrate chemolithoautotrophy (on which substrate) ...
5
votes
1answer
62 views

Calling for Free Online Data for Paediatric ECG?

I need free online data about heart murmurs to study these: heart murmur frequency , S2 heart sound frequency and its split, murmur timing, and duration, murmur intensity, S3 sound presence and ...
5
votes
1answer
43 views

Is there a karyotype database for human cell lines?

I'm looking for the karyotype of a specific cell line. Some karyotype are well known, such as HeLa or some carcinomas, but some are very hard to find, such as LG2 (B cells). Is there a database ...
4
votes
1answer
136 views

What do “e” “-” “C” and “E” mean in this output?

I have given an input of this protein sequence: MEPVDPRLEPWKHPGSQPKTACTTCYCKKCCFHCQVCFTTKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQPRGDPTGPKE from this website along ...
4
votes
1answer
60 views

How to seek for available genetic data relevant to ecology and evolution?

I had a quick look online. There seems to exist many different website of database archiving. Some data might be free of charge while some others might not be. I found things such as Dryad, TreeBase, ...
4
votes
1answer
199 views

Local storage of NCBI database in MongoDB [closed]

My short term goal in a project is to build a local database of the NCBI dbSNP database. The data and schema are available on the FTP site(). I was going to implement the database using MySQL, but I ...
4
votes
1answer
123 views

Antibody-antigen database

Is there a database where I can find an affinity estimate if I provide a given antibody and a given antigen sequence ? Input : antibody + antigen sequence Output : quantitative binding/affinity ...
4
votes
2answers
121 views

Database of Multicellular and Unicellular organisms?

I'm trying to annotate a list of organisms taken from NCBI for cellularity (unicellular or multicellular). Does any of you ever found a database with association between an organisms' name or taxa and ...
3
votes
1answer
56 views

Resources of all known biochemical pathways?

I am looking for a encyclopedia or biochemical pathway atlas of all known or reported pathways. I am very much interested in network and systems biology. Also the references can be open databases, ...
3
votes
1answer
126 views

Do there exist publicly available Genome sequences of a family?

I would like to explore the genome sequence of a publicly available genome sequences of a family (like mother, father, son, daughter...). If such human genome sequences are not publicly available at ...
3
votes
1answer
45 views

What is the difference between “physical interaction” and “genetic interaction”?

I searched sac1 in uniprot to know more about this gene. in interaction I selected this link and there I see that this gene has some "physical interactions" and "genetic interactions". I am wondering ...
3
votes
1answer
45 views

Is there any database with RNA classification?

I am looking for a database that would provide classification of various types of RNA - information about its structure, function, etc.
3
votes
1answer
89 views

What is a good source for info on disease frequency distribution among age groups?

I need information on the disease frequency distribution among age groups for an Android app I'm building... Hopefully I've come to the right place. Is there a good data source for this? Like a ...
3
votes
0answers
51 views

Database of Medical Assertions

Can anyone point me toward a computationally-accessible database of medical assertions? I'm looking for something where each row in the database contains a single unit of knowledge. It could either be ...
2
votes
3answers
134 views

Is there an online gene library? [closed]

Is there an online library that includes all known genes in stored in their nucleotide form of all living organisms? Note I am not necessarily looking for a human only database. If such a database ...
2
votes
1answer
33 views

Why is there a compound highlighted in red in a KEGG Module search?

Considering the following module: http://www.kegg.jp/kegg-bin/show_module?M00115+C00003 why is the compound C00003 marked in red?
2
votes
2answers
93 views

Downloading specific yeast genes in an automated manner?

I have 6 genes of Candida albicans yeast namely orf19.723, orf19.5908, orf19.610, ...
2
votes
1answer
140 views

What does chromosome CHR_Un, CHR_MT in the ftp site of NCBI mean?

I am not a biologist. But need some genetic data. So I searched internet and reached NCBI's website. I came to know from the FAQ page that I can the complete genome data of organisms from ...
2
votes
1answer
42 views

Database of medically validated SNPs

I'm looking for all possible sources of clinically tested human SNPs. There is a handful of databases that store SNPs (like dbSNP), but I only need those that have validated presence/absence of ...
2
votes
1answer
69 views

Where to obtain metabolic pathway datasets

I've been looking through the files available at www.reactome.org along with some others but I only find images/pdfs of metabolic pathway diagrams. Where is the actual data these pathways are drawn ...
2
votes
2answers
427 views

What's a good and reliable database on the pharmacodynamic and pharmacokinetic data of drugs both approved and unapproved?

What's a good and reliable database for the pharmacodynamic and pharmacokinetic data of drugs both approved (in the US and elsewhere) and unapproved?
2
votes
2answers
302 views

Are there any open plant databases (database/library/collection), containing species information and pictures?

I would like to download a plant database containing photos and species details. Do you know if there are any openly available online?
2
votes
1answer
81 views

What type of distribution should binding affinities fit?

I've been averaging Ki values from the PDSP Ki Database, and I can't help but to wonder: how I can determine p values for the binding affinities, so I can exclude anomalies in the data if need be?
2
votes
0answers
35 views

How to gather life-history traits data on bird species?

I am looking for a data base of life history traits for bird species. Is there such data base? If not, what are your advice on how to collect those data? Is there a handy website that list ...
2
votes
0answers
58 views

Is there a database of known riboswitches?

I'm looking for sequences and annotations of known riboswitches, but so far I haven't found a resource that actually fulfills my requirements. The best database I found so far is Rfam, which has ...
2
votes
0answers
43 views

dbSNP database table desciptions

I am trying to build a local implementation of dbSNP. I would like to know the descriptions of tables listed on ftp://ftp.ncbi.nlm.nih.gov/snp/database/organism_data/human_9606 and on ...
1
vote
2answers
41 views

Difference between modules in KEGG Module

The KEGG module M00115 includes a set of reactions while M00542 does not have any; it just shows the list of enzymes. Is the reaction set for M00542 still unknown?
1
vote
2answers
194 views

What are the rules for plasmid names?

What are best practices for naming newly created plasmids? For example, a common format is pABC123. What is the exact specification? Must there be 3 letters? What ...
1
vote
1answer
39 views

programmatic fast search of 100-1000 short reads to a public server and obtain list of nearby genes

What are the options for programmatic fast searching of 100-1000 short reads to a public server and obtain list of nearby genes where the reads map? Input: ~100-1000 short reads Output: GFF list of ...
1
vote
1answer
68 views

Is there any bank of animations for Embryology?

I am trying to find animations which can anonymous or generalised for Embryology. However, I have not find any single good source. Is there any bank of animations for generalised embryos?
1
vote
1answer
42 views

What are good data on the Human Metabolic Model and where can I get them?

Trying to get a good SBML representation of the Human Metabolic Model for use in Flux Balance Analysis and drug targetting (i.e. gene knockout) simulations. What are good sources for these data? ...
1
vote
1answer
298 views

What are the differences between HPRD and BIOGRID databases?

What are the differences between HPRD and BIOGRID protein-protein interactions databases? What are their purposes? Why do we need two different databases? How is data collected into each one? How ...
1
vote
1answer
13 views

What information does the KEGG Module statistics page show?

While browsing through the home page of KEGG Module, I clicked the button named Module statistics. Can someone tell me what does these numbers signify? What are they the statistics of?
1
vote
1answer
22 views

Human population growth - where can I find the data?

Out of curiosity, I'd like play around with data of human global demography. Where can I find data that describe the "per region (per continent for example) population size" versus time since the ...
1
vote
1answer
19 views

Any databases with AAMI ECG and ECHO?

There is no AAMI 12-lead ECG databases available online. All of them have problems. I and my friends finally finalised our tests with St Petersburg. It is not AAMI. So the next step is to search ...
1
vote
1answer
59 views

Dataset of microscopic images before and after staining?

I am looking for a freely distributed dataset of microscopic images. I am hoping to find a dataset that would feature histological images before and after staining (e.g. H&E or some other standard ...
1
vote
1answer
110 views

Why are low throughput methods more trustable for protein interaction?

I read that protein interactions found using high throughput methods are less trustable than those found using low throughput methods. For example, searching for interaction of BRCA2 on BioGRID, I ...
1
vote
1answer
94 views

Modeling yeast biochemical pathway using enzyme kinetics

I need enzyme concentration and metabolites concentration values to en-corporate these values in my model and do some simulation. I searched through some database yeast metabolome database ...
1
vote
0answers
70 views

Where can I find mutation datasets for cancer (other than TCGA)?

My lab has been using TCGA data (somatic mutations and clinical data) to develop panels of genes and of mutations we expect to see in certain cancer populations. We'd like to validate our panels by ...
1
vote
0answers
32 views

Download FunCat Database for Programmatic Access

I am enriching RNA-seq data for the fungus Neurospora crassa and would like to be able to search the genome by functional category, determine similarity of genes by category membership, and any other ...
1
vote
0answers
16 views

Recombination frequency as a function of genomic location in E coli?

Are there any databases or papers that give recombination frequency as a function of position in the E coli genome?
1
vote
0answers
28 views

Is there a database of pollen-seed distances across plant species?

I was enjoying Richard Smith's excellent answer to this question, and wondered: If you consider the pollen/seed distribution range to be plant locomotion, is there a database that compares these ...
0
votes
2answers
77 views

Difficulties understanding a pathway [closed]

I am not a biologist and I would love to understand what is going on with this pathway. I went to the description but it's still complicated, and I couldn't follow. Can someone please help me with it? ...
0
votes
1answer
25 views

Presence of reaction module in bacteria but not in Eukaryotas (human)

From the statistics page, I found that the Module-M00008 is present only in bacteria and not Eukaryotes. Why so? I noticed that all the compounds necessary or the reaction are present in human body ...
0
votes
1answer
30 views

How reliable is SwissProt topology?

I am using TOPO_DOM annotations from uniprot databases to characterise the orientation of transmembrane features. Is SwissProt topology experimentally validated, ...
0
votes
1answer
54 views

Finding Rna-Seq dataset for C. Elegans (Caenorhabditis elegans)

I want to find a RNA-Seq dataset for C. Elegans to use it in RNA-Skim software. For those who does not know RNA-Skim let me explain it a bit. It is a tool which is used to quantify RNA-Seq data using ...
0
votes
2answers
34 views

Resource for finding what proteins bind?

I have two lists of proteins (including phosphorylated forms). I want to determine which members of each list act on which members of the other list. What online resources exist for finding out what a ...
-4
votes
1answer
28 views

From where can I download the database created by Hsu et al for MORFs? [closed]

I am working on an independent research project for which I require access to the MORF database created by Hsu et al. From where can I download the database of MORFs of IDPs and their binding partners ...