The study of the molecular processes of the nucleus and cell function.

learn more… | top users | synonyms

0
votes
1answer
33 views

Plasmolysis vs Flaccidity in cells

When is a cell said to be flaccid and when is it called plasmolysed? So far I found that there is a specific relation to osmosis.
5
votes
1answer
125 views

Can bacteria, viruses, and cancer cells be destroyed by resonance?

Radiotherapy has been used to treat cancer. Can the resonances by coordinated electromagnetic waves (and/or other forms of waves), of various frequencies, amplitudes and pulse rates, directed from ...
0
votes
0answers
36 views

CRISPR Cas9 most updated paper protocol

I am collecting literature to start a new project on CRISPR Cas9 gene editing. I must put together a protocol to start asap. I am intending to use the following paper as guidance: "Genome ...
1
vote
1answer
38 views

What is a “noninvasive” biomarker for a disease? [closed]

What is a "noninvasive" biomarker for a disease? I know what a biomarker is, but what makes it noninvasive?
0
votes
0answers
14 views

Optimum gibson assembly overlap length

Does anyone know the optimum length of overlap your primers should have to your vector for gibson assembly. Most manufacturers say to do at least 20 bp on both side but don't give a maximum. Sometimes ...
2
votes
1answer
31 views

Question about Enzyme Inhibition in relation to Aspirin

I've been trying to learn a bit more about pharmacology, so bear with my ignorance. In short, I see that aspirin (in part) works by inhibiting cycloxygenase isoenzymes and that this inhibiting is ...
1
vote
0answers
12 views

SSR Association Mapping [closed]

I do association mapping of SSR with the help of the bioinformatics tool "Tassel v 2.1". Can any one tell me about Ls Mean in GLM. Actually, when I click on "add Ls Mean data" for output the software ...
10
votes
2answers
246 views

Why do mitochondria fuse together?

Contrary to all of the textbook images of mitochondria that I have seen over the years, I had just learned that the mitochondria within a cell form a dynamic branching network along microtubule ...
1
vote
2answers
55 views

CRISPR/Cas for editing the human genome [closed]

I know, that the CRISP/Cas approach for "cutting" the human genome is not completely suitable if we can't say not suitable at all. Because we have many repeats and this approach can bring to our ...
3
votes
1answer
47 views

What is a regulable promoter? And how does one regulate it?

I'm reading a patent where they (in S. cerevisae YNP5 strain): downregulate the ERG9 gene by replacing the native ERG9 promoter with the regulable MET3 promoter What's a regulable promoter and ...
3
votes
2answers
81 views

Is “A” inhibiting “B” and vice-versa, a positive feedback loop?

If product A inhibits the expression of product B, and product B inhibits the expression of product A, is this a positive feedback loop? My thinking was to consider the scenario that A starts off ...
4
votes
2answers
219 views

Randomness in living systems

The point of my question is not to talk about events that are uncontrolled by living organisms. My question is about controlled randomness, or I'd like to say adaptive random process. Process that are ...
4
votes
1answer
190 views

What do “e” “-” “C” and “E” mean in this output?

I have given an input of this protein sequence: MEPVDPRLEPWKHPGSQPKTACTTCYCKKCCFHCQVCFTTKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQPRGDPTGPKE from this website along ...
0
votes
1answer
27 views

Random Mutagenesis vs Directed Evolution as Strategies to boost expression

Do people use random mutagenesis (say using UV) to generate host variants that have high expression of a metabolite / enzyme? I've seen it mentioned as a strategy but it confuses me as to why. How ...
12
votes
2answers
212 views

How can we verify predictions of protein folding in silico?

Currently, there is a lot of research focused on solving the folding patterns of proteins using computers (Folding@Home, https://fold.it/portal/, etc.). The question that I have is: How do you know ...
3
votes
0answers
59 views

What Chemical Trigger Causes Ectomycorrhiza To Change From Asexual To Sexual?

I want to know the trigger behind the change of asexual to sexual ectomycorrhiza when symbiosis with a tree root is formed. As ectomycorrhiza attaches itself to a root, it forms a relationship wherein ...
3
votes
1answer
236 views

Where do the H+ ions come from in light reactions?

In the light-dependent reactions of photosynthesis, H+ ions pass to the thylakoid space. Where do these protons come from?
1
vote
1answer
31 views

Difference between pulse coupling and diffusive coupling In biological oscillators

What are the differences between pulse coupling found among neuron cells and diffusive coupling found in cells that exhibit calcium waves? Moreover, in both methods, is it a strict requirement that ...
3
votes
1answer
80 views

Does size matter?

As I compare the morphologic differences between mouse models and the human disease for which they are analogous, I have become interested in what difference interspecies size has on molecular ...
1
vote
1answer
55 views

Does adding antibiotic after 5-10 mins of innoculation affect the protein yield or growth?

I've asked a lab colleague the same question. She said, it would loosen the bacterial cells in the LB medium and plasmids would come out. Is that true? and why?
1
vote
2answers
64 views

Are there proteins that stabilize mRNA:RNA polymerase or mRNA:ribosome complex?

Actinomycetes are known for their ability to produce rich variety of natural products, and particularly, polyketides. Many of the genes that encode the biosynthetic pathways are pretty big, as they ...
3
votes
1answer
3k views

What's the physical meaning of Svedberg unit?

Sedimentation coefficients, using a centrifuge, are expressed using Svedberg unit (symbol S, sometimes Sv). Wikipedia states that $S = 10^{-13}$ sec but I also saw in a book that actually $S = 10^{-13}...
2
votes
1answer
77 views

Genomic DNA isolation from wheat

Can I use dry seed, wheat for example, in place of young leaves for isolation and purification of genomic DNA for PCR amplification? The goal of my experiment is to validate a novel gene which is ...
0
votes
0answers
18 views

Transgenic zebrafish: what are some reasons for the constructs not working?

My Master's project is about generating some zebrafish transgenic lines and for that purpose I've cloned 2 new constructs, taking the promoter from a pre-existing plasmid and the vector backbone (...
4
votes
1answer
60 views

Directed evolution: Point mutation vs Insertion-Deletion vs Shuffling

When attempting enzyme function improvement via Directed Evolution I can see three different strategies to generating variation for the gene sequence: Point mutations Insertion / Deletions Shuffling ...
0
votes
0answers
8 views

What is the role of Glycine in SDS-PAGE [duplicate]

We are using glycine in SDS-PAGE running buffer. What does it actually do? I found out that it maintains the pH and prevents sample damage. Does it play any other role and can it have any alternative?
5
votes
1answer
150 views

enzymes that stabilize DNA loops

As a follow-up of a previous question, I would like to know what enzymes or protein complexes have been used to manipulate DNA samples into stabilizing DNA loops. I have read that cohesin is one of ...
7
votes
3answers
14k views

What's the difference between shotgun sequencing and clone based sequencing?

In a lecture during my undergraduate degree we were introduced to the race to complete the human genome. Celera were competing with Sanger and collaborators to sequence the human genome. Celera ...
0
votes
0answers
4 views

Plant symbiosis, alternative regulation pathways to AON and miRNA399?

I am currently studying systemic repression of both arbuscular mycorrhizae and nitrogen fixing bacteria in legumes. I know of the AON pathway (which works through CLE and NARK). I also know of ...
4
votes
1answer
86 views

Why is an A-U bond less stable than an A-T bond?

I have encountered the following fact many times, but have not yet encountered a possible explanation for it. Will you please help me understand the molecular mechanism by which the bond between ...
34
votes
4answers
818 views

Why are amino acids in biology homochiral?

Why are nearly all amino acids in organisms left-handed (exception is glycine which has no isomer) when abiotic samples typical have an even mix of left- and right-handed molecules?
5
votes
1answer
81 views

Can difference in the expression potential of alleles lead to dominance?

Several hour ago I was in thoughts what allele dominance really means on molecular level. As we know from basic genetics, if the organism had Aa type of some gene ...
1
vote
1answer
41 views

Yeast Strain with squalene synthase / farnesyltransferase (ERG9) gene deleted

I was interested in obtaining a yeast strain without the enzyme farnesyltransferase (Which catalyses conversion of FPP to Squalene). The Euroscraf database has thousands of yeast strains with ...
3
votes
1answer
59 views

Genomic DNA resuspension after ethanol precipitation

I am having trouble resuspending purified human genomic DNA. The genomic DNA is purified using phenol:chlorofom from ~ 1 mL of blood. After ethanol precipitation, I normally see a large pellet which ...
4
votes
2answers
85 views

How to safely conserve my current DNA methylation marks?

I read the Wikipedia article on DNA methylation Let's say I want to extract and then stock my current DNA methylation marks somewhere so that I can use it safely 20 years in the future for a medical ...
1
vote
2answers
48 views

difference between transcriptional activator and general transcription factors?

What is the difference between transcriptional activator and general transcription factors? Are they same or different, and do the transcriptional activators first attract general transcription ...
1
vote
0answers
63 views

Genomic DNA extraction protocol by salting out with NaCl, how to improve yield

In these papers A rapid non-enzymatic method for the preparation of HMW DNA from blood for RFLP studies A simple salting out procedure for extracting DNA from human nucleated cells Modified salting-...
4
votes
1answer
38 views

How much time do the different mechanisms of gene regulation need to take effect?

I am thinking of the major regulatory mechanisms, like general transcription factors, activators, repressors, and RNA interference. If non-active regulator genes using each of the different ...
7
votes
1answer
56 views

Does copper exacerbate wounds?

There is a three edged stiletto (weapon, not shoe) with a triangular cross-section that is often touted as being "extra dangerous" because of the triangular puncture it makes, and its copper ...
12
votes
2answers
2k views

Why is there more variation in proteins than genes?

The Genome of a cell or organism is the same as that of the entire organism. However, the proteome of an organism is much greater than that of each cell (unless the organism is unicellular). How do ...
4
votes
1answer
48 views

A good software for agent based modelling?

Hello i'm gonna start my master degree in systems biology and i'm thinking of working with agent based modelling, but i really don´t know which platform can be the best to simulate interactions ...
2
votes
2answers
93 views

Why mutations in genes involved in general processes like DNA repair increase the risk of developing specific types of cancer?

For example, mutation in MHS2, which encodes a protein involved in the repair of mismatches that occur during DNA replication, dramatically increases the risk of developing colon cancer. (There are ...
1
vote
1answer
19 views

When should you use a stringent plasmid

I was wondering if anyone had good examples of when you would want to use a stringent plasmid vs a relaxed plasmid in a research setting. Thanks
0
votes
0answers
29 views

Do any gaps in DNA during cell division (meiosis in particular) lead to crossover?

I have some gaps in the knowledge abour crossover. I know, that crossover is connected with reparation process. I'd like to know if all gaps in chromosomes lead to crossover (reparation based on 2d ...
1
vote
1answer
77 views

Goodwin oscillator explained

Hello I have been reading papers about the Goodwin oscillator and I found that the equations are kind of tricky. Specially the part of the hill coefficient. In his paper "An entrainment model for ...
0
votes
1answer
33 views

Why do RNAi pathway proteins exist in the nematode when they can cause them harm?

When dsRNA is injected in plant, Dicer cuts it and prevents disease. Why would the plant parasite, M. incognita - a nematode, die when dsRNA was injected in it? It should have saved it. Again, to be ...
0
votes
0answers
27 views

Artificial Synthesis of Animal Cells

If we know the elements with which a certain type of cell is composed of (I am particularly talking about Animals, and Humans more importantly), why aren't we able to make cells on our own then, in a ...
1
vote
0answers
29 views

UV light-induced mutagenesis during gel extraction

this is a very short question I did not find the answer for online, neither on this nor other fora. At the beginning of my cloning protocol, I extracted the band with the sequence of interest directly ...
1
vote
0answers
17 views

de novo gene synthesis vs cDNA library creation from plant RNA: Pros & Cons

What are the relative pros & cons of the following two approaches when one wants to insert a known, sequenced plant gene into a target host organism: de novo gene synthesis vs plant matter ...
13
votes
1answer
16k views

Why is ATP the preferred choice for energy carriers?

Why is ATP the most prevalent form of chemical energy storage and utilization in most cells?