Biopolymers consisting of amino acids that fold into 3D shapes and perform a large number of functions in living organisms.

learn more… | top users | synonyms

0
votes
1answer
23 views

What are the binding sites (or receptors) of cortisol?

I am in the process of a OCR GCSE Case Study, and my question is "Do the benefits of anabolic steroids outweigh the risks, which has an obvious conclusion. I need to know the scientific name, or a ...
2
votes
4answers
421 views

Bacterial cell lysis buffer used in proteomics procedures

What kinds of detergent-free bacterial lysis buffers exist? The proteins we're extracting will be later analyzed by LC-MS/MS, and we're looking for a lysis buffer that won't interfere with this ...
1
vote
0answers
33 views

Proteins in water vs proteins in crystal

I am not very familiar with the experimental procedure of x-ray crystallography except that it involves the very delicate matter of producing crystal that contain proteins and then diffracting rays ...
2
votes
2answers
48 views

Server for protein structure prediction for multiple sequences

Does anybody have any idea about any online server that takes in multiple amino acid sequences in fasta format and outputs the 3D structure of the input amino acid sequences in the form of helix, ...
5
votes
1answer
64 views

Electrophoresis of hemoglobin from a carrier for sickle cell anemia shows two bands - why not three?

Electrophoresis of hemoglobin from a carrier for sickle cell anemia shows two bands - why not three? Since there are two beta chains in each hemoglobin, it seems to me they should have three types of ...
2
votes
1answer
59 views

Why don't membrane proteins move?

I understand that based on their tertiary structure, intrinsic proteins have hydrophobic non-polar R-groups on their surface and that they 'interact with the hydrophobic core of the cell membrane to ...
1
vote
0answers
34 views

Similarity with protein sequence [closed]

I have chosen a protein sequence and I want to record the sequences having similarity more than 85% of the chosen sequence. How can I find it using FASTA?
2
votes
0answers
34 views

Estimated protein size using CDs data [closed]

The number of amino acids in a protein is important to predict their size. I used coding DNA sequence (CDs) to predict the average of the protein size of E.coli k12 from a sample provided by the ...
2
votes
2answers
36 views

How to obtain a list of proteins sorted by the ~1400 unique protein folds?

The databases CATH and SCOP both have around 1400 unique protein folds recorded from analysis of the PDB. However, I do not see any method to access this particular data. A list of each of the 1400 ...
11
votes
1answer
328 views

What is the transmembrane 'Positive-Inside Rule' nowadays? Has the definition changed over time?

First definition. Two publications by von Heijne in 1989 and 1992 coined the 'Positive-Inside rule' and showed it's practical value in topology prediction of transmembrane helices. It was clearly ...
0
votes
0answers
10 views

Bence-Jones proteins in urine on heat

The preliminary test for proteinuria is precipitation/turbidity on heat due to denaturation. This turbidity should not disappear when 10% acetic acid is added - to differentiate from phosphates. ...
-2
votes
2answers
38 views

Why can't proteins make copies of themselves? [closed]

Why is it impossible for proteins to make copies of themselves?
2
votes
1answer
54 views

Difference between the P4 and P5 subtypes of P-type ATPases in plants

In plants there are various kinds of P-type ATPases. What is difference between P4-ATPase and P5-ATPase?
1
vote
2answers
34 views

How do prions transmit their conformation to other proteins?

I was reading about prions and many sources say something to this effect: "Prions may propagate by transmitting their misfolded protein state: When a prion enters a healthy organism, it induces ...
0
votes
0answers
23 views

Which proteins cross the blood brain barrier?

Are there any known globular proteins which naturally cross the blood brain barrier as part of their function, i.e., without modification? I'm thinking not just human proteins, but also viral ...
4
votes
1answer
185 views

What do “e” “-” “C” and “E” mean in this output?

I have given an input of this protein sequence: MEPVDPRLEPWKHPGSQPKTACTTCYCKKCCFHCQVCFTTKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQPRGDPTGPKE from this website along ...
1
vote
0answers
38 views

What is the most stable globular protein?

What is the most thermodynamically stable globular protein? I am looking for a small (ideally less than 50kDa) soluble globular protein motif which folds easily/reliably and is known to be extremely ...
12
votes
2answers
198 views

How can we verify predictions of protein folding in silico?

Currently, there is a lot of research focused on solving the folding patterns of proteins using computers (Folding@Home, https://fold.it/portal/, etc.). The question that I have is: How do you know ...
1
vote
1answer
44 views

Does the order of amino acids matter in making up a protein?

For instance, if a protein is made of 2 amino acids, that is, AB, would the same protein form if the order of combination of amino acids become BA? If yes, would the behavior of interaction of that ...
6
votes
4answers
171 views

Do all cells produce the same proteins?

If DNA is more or less the same in all cells, and DNA is used to produce proteins from aminoacids, then do all cells produce the same proteins or are they specialised/controlled by something?
3
votes
0answers
16 views

What are the secondary structure requirements for cell-penetrating peptides AKA protein transduction domains

Some background: Cell penetrating peptides (CPPs) are a class of short amino acid sequences which are sufficient for crossing cell membranes and delivering themselves along with any attached cargo ...
2
votes
1answer
40 views

Do residue sequence numbers in PDB files correspond to the positions in the backbone?

In other words if two residues have sequence numbers, say, 20 and 21 then are they next to each other in the backbone? If no (or not necessarily) then is there any way to find consecutive residues ...
0
votes
1answer
37 views

Relative concentration of enzyme vs reaction product

I was reading a paper in which a recombinant protein (His-6 tagged) is expressed in E Coli (BL21 DE3). The yield of the enzyme isolated from the culture is reported as 10-30 mg per L of bacterial ...
0
votes
0answers
21 views

Best protocol to optimize solubilization of bacterial fusion proteins?

I'm trying to produce an His-tagged protein in E.coli. Before performing the Ni-NTA column I need to figure out how to extract most of the protein from the cell pellet but I'm getting lost with a ...
1
vote
1answer
25 views

Hydrophobic proteins in the body?

I know that we can get hydrophobic amino acids, but are there any proteins in the body whose surface is hydrophobic? If so what is their typical function and where can they typically be found and if ...
2
votes
0answers
36 views

Structure of proteins

Regarding the secondary structure of proteins, I know that there are 3 main types. The beta sheet formation is made up of beta strands stabilized by hydrogen bonds to form an anti parallel or a ...
0
votes
1answer
98 views

If human proteins are synthesized from only 20 different amino acids, then how can there be such variety of proteins in human cells?

I know that human proteins are synthesized using only 20 different amino acids. However, how can there be thousands of different proteins in human cells, if we only use 20 amino acids to make them?
0
votes
1answer
44 views

A molecular marker for global protein synthesis

I know that protein synthesis is governed by a lot of factors (I'm mostly studying the mTOR pathway), but I'm looking for some kind of marker that will indicate the global protein synthesis rates. I ...
1
vote
0answers
27 views

How accurate are proteomic-based biomarkers of cancer? [closed]

Currently protein expression is one of the widely used biomarker types. For example, any $i^{th}$ protein could be a selected biomarker. How can a minute change in single protein concentration ...
2
votes
1answer
46 views

Conserved acetylation sites in a given protein

I want to identify potential conserved Acetylation sites in protein X. As it is known, acetylation happens in Lysines (K), thereby I would like to identify conserved K residues for protein X during ...
1
vote
0answers
24 views

Can aptamers be used to identify the terminal amino acid residue of a peptide?

Suppose there were DNA or RNA aptamers that bind specifically to a certain terminal amino acid residue. Let's name it aaSA (amino acid specific aptamer). For example, the aptamer binding to terminal ...
0
votes
0answers
21 views

How does Ultra-pasteurized milk compare with pasteurized milk?

I am specifically interested in whether all proteins and nutrients lose their structure permanently because of the very high temperature of ultra-pasteurization. What is the case for pasteurized ...
5
votes
1answer
65 views

Is it possible to isolate and analyse intermediates of protein folding?

I would like to know if there is an assay which could allow us to analyse a protein before it has assumed its 3D functional form. While studying structural biology, I only came to know the forces that ...
3
votes
1answer
140 views

What is an isolated beta bridge?

DSSP gives the letter B for a "residue in isolated β-bridge (single pair β-sheet hydrogen bond formation)", according to Wikipedias page for secondary structure (and various other proper sources). Can ...
4
votes
1answer
74 views

How to get the correct RefSeq Protein transcript for a given RefSeq Nucleotide transcript?

How to get versioned Protein Accession Number for a Refseq Accession Number? I have some versioned RefSeq Accession numbers and I would like to know their corresponding Protein Accession Numbers. ...
0
votes
1answer
59 views

Predicting 3D structure of a protein?

While predicting 3D structure of a protein through homology modeling, the most important step is Multiple Sequence Alignment of template sequences with the target protein whose 3D model is to be ...
10
votes
2answers
140 views

Protein tertiary Structure formation

As we know that coils and loops are evolutionary variable regions where mutations,deletions, and insertions frequently occur. So does it mean that they don't have much role in the structure of ...
4
votes
0answers
29 views

Derivation of Michaelis' Equation from Michaelis' Constants [duplicate]

The enzyme reaction condition, $E + S \leftrightarrow ES \rightarrow E + P$ uses $\kappa_{1}$ (forward reaction), $\kappa_{-1}$ and $\kappa_{2}$ as the rate constants. E: Enzyme S: Substrate P: ...
2
votes
1answer
64 views

Why does heating kidney beans at a low temperature potentiate the toxicity of phytohaemagglutinin?

I recently found out that red kidney beans contain a relatively high amount of the toxic lectin, phytohaemagglutinin. An article on phytohaemagglutinin on the FDA website states: Several ...
1
vote
1answer
23 views

What are in common between transcription factors?

In terms of their structures (primary to tertiary) and locations? Why do they have these commonalities? Or are any of these commonalities critical to their functions?
3
votes
1answer
63 views
4
votes
1answer
84 views

What is the process of degradation of proteins into amino acids inside living cells?

Just like beta oxidation does our cells have a distinct mechanism for degradation of proteins? There are processes for degradation of amino acids but where does these amino acids come from, is it all ...
2
votes
2answers
68 views

What are some useful physical information of a protein?

Beside energy and heat, I don't know any useful physical information of a protein. Can you help me list some of it. Somethings like Fourier-transform infrared spectroscopy to provide protein structure ...
0
votes
1answer
60 views

Why do raw prawns turn red after sitting in vinegar?

Yesterday morning I put some raw prawns (shell removed) into vinegar (more specific this one), and put them in fridge. When I came back at night all of them turned red, which looks cooked, except ...
0
votes
0answers
31 views

How hydrophilic is human mucus?

I am interested in the stability of virus particles in human mucus, and how this may bias the evolution of surface amino acids in respiratory viruses. For instance if the mucus environment were more ...
0
votes
0answers
11 views

Are receptors integral membrane proteins or peripheral membrane proteins?

In tegral membranes serve as transporters. Peripheral protiens serve as cell adhesion molecules, antigens and enzymes. So what about receptors? Which protiens carry out the duty of receptors?
1
vote
1answer
41 views

What is internal symmetry in membrane proteins?

I have come across the term "internal symmetry" in the context of membrane proteins, but have never found a satisfactory definition. I'm struggling to figure out exactly what this term means... What ...
1
vote
0answers
25 views

mRNA extraction from mice ears.

I am trying to extract RNA from mice ears and for some reason I don't have RNA when I perform the electrophoresis. I directly cut the ears and I put it in a tube with a bead and trizol. then I place ...
2
votes
0answers
28 views

Lifeforms concentrations of the categories of macromolecules, and Lipids

Lifeforms are formed of large, modular, organic molecules called macromolecules, large organic molecules called Lipids, and simpler molecules such as H2O. Macromolecules are commonly grouped into the ...
2
votes
3answers
464 views

Amplification technique for proteins similar to PCR for DNA?

I know PCR can be used to amplify a tiny sample of DNA in order to perform experiments. Is there a similar technique to use on a protein sample? More specifically, I'm not interested in "cutting" up ...