4
votes
2answers
181 views

What is a triglyceride?

I'm confused on what a triglyceride is, from what my text book it says its a type of gylercide, then from a website it said Glycerides can be subdivided into two categories. The first group, the ...
3
votes
1answer
68 views

Can anyone identify the worm in this video clip?

My wife came across this youtube clip of a spider and a worm. Can anyone identify at least the phylum?
7
votes
2answers
1k views

What is a group of tortoises called?

This post at Mental Floss stated that a group of tortoises is called a 'Creep'. I had never heard of that before, and in trying to find the references for the name, I was surprised that I couldn't ...
5
votes
3answers
422 views

What advantage does an enzyme serve over catalysis by the addition of heat energy?

I understand that an enzyme lowers the activation energy, allowing the reaction to run faster, however I am not sure, how it may be favorable during the addition of heat energy. Wouldn't that lower ...
1
vote
1answer
200 views

What flower is this blue flower? [closed]

What flower is this? All help would be appreciated
3
votes
1answer
2k views

Do these things contain amylase? [closed]

I have 10 samples of some food or other things and I need to know, if it contains amylase. I already ran an experiment with storch and iodine, but I have to make it right and my experiment must not be ...
2
votes
1answer
65 views

Why does uterus have to be prepared every month for fertilization?

I'm just curious why it has to happen every month when the uterus could have been prepared from the beginning and kept that way throughout life or till a certain point. But why make and break it every ...
1
vote
0answers
38 views

What is the fruit of Café marron (Ramosmania rodriguesi) like? [closed]

I have read the article about Ramosmania rodriguesi (Café marron) and I've grown intrigued about what the fruit of this specie tastes like? Moreover, is it edible or "brew-able"? The only pictures ...
2
votes
1answer
30 views

By what method do ants dissect and hold soil

Not sure if this is the correct stackexchange site - please migrate/advise as you see fit. I'm interested in the method by which ants "break off" a small amount of soil and then hold it in their jaws ...
2
votes
2answers
526 views

What is the meaning of dots and dashes in clustalw?

I am converting outputs in stockholm format to clustalw using ...
-1
votes
1answer
37 views

What is some computer science technology that can help the development of biology? [closed]

What is some computer science technology that can help the development of biology(eg. artificial intelligence, resolution technology) and briefly talks about their potentials?
1
vote
2answers
61 views

How do I find a protein from this DNA sequence?

I have a DNA sequence from a sequencer. How can I determine what protein is it? I tried some translator but it didn't help. What protein is this and how can I determine it? The sequence: ...
3
votes
1answer
141 views

Does long term use of antibiotics in humans actually lead to a greater risk of infection?

I've read about the overuse of antibiotics leading to antibiotic resistant strains of bacteria, so generally does long term use of antibiotics breed these strains in the bodies of antibiotic users and ...
1
vote
1answer
50 views

Is there a biological environment that we can we assume glutamate exists as glutamic acid?

In the body we almost always assume that glutamate exists as glutamate rather than glutamic acid. It is so commonly glutamate yet glutamic acid and glutamate share the abbreviations of Glu and E. From ...
9
votes
1answer
10k views

Name (and meaning of the absence) of the white semicircle at the base of the fingernail?

At the base of fingernail, there is a white semicircle (see on the first picture). But sometimes there isn't one. My questions are: what is this white semicircle on the fingernail, and what causes ...
2
votes
2answers
130 views

How to preserve leaves between sampling (collection) and analysis?

Suppose I spend a day in a forest, collecting different kinds of leaves, which I would like to analyze under a compound microscope. Now, obviously, measures should be taken to preserve the leaves some ...
1
vote
0answers
19 views

How to study the number of herbivores per type of tree and time of day?

Suppose I want to find out the number of herbivores in different kinds of trees, and also compare the numbers between day and night. How would this kind of study be run in practice? It easy to think ...
4
votes
1answer
76 views

How can I reduce the background gradient in phase contrast microscopy?

I'm looking for ways to set up a phase contrast microscope to reduce the brightness gradient that appears across the background of my images. I use phase contrast to find the outlines of cells in my ...
1
vote
1answer
32 views

Is it a medical condition to not able to recall the word in a language while having a conversation [closed]

While having a conversation it happens to some peopl that clearly they know there exists a perfect word to be used but can not recall it during the conversation in real time and hence forced to use ...
1
vote
0answers
51 views

Hot water bath and Infertility

From here: Effect of temperature. Sperm cells will not mature at core body temperature in most mammals (spermatogenic DNA polymerase b and recombinase activities exhibit unique temperature ...
1
vote
1answer
96 views

How do butterflies defend themselves from other creatures when they don't have the ability to sting or some other offensive/defensive mechanism?

How do butterflies defend themselves from other creatures when they don't have the ability to sting or some other offensive/defensive mechanism? Butterflies are part of the class of Insects in the ...
11
votes
2answers
1k views

Why cancer is not a communicable disease?

I have seen this question where the author is asking a question about infectivity of virus. I wish to know why cancer is not a communicable disease?
2
votes
2answers
253 views

Is fever a disease or not?

I have seen this question where the author is asking why people take drugs for fever. So my question is: Is fever is a disease or not?
7
votes
1answer
2k views

Why do human eyes glow red on a photo and dog's eyes green?

Previous Research I know that cameras sometimes come with an anti "red eye" functionality that involves two flashes, presumably the second flash coincides with the shutter opening. Question Why do ...
7
votes
1answer
101 views

Is using Hidden Markov Models to find homologues sensible in abstract, short sequences?

HMM alignment tools like hhpred excel at finding subtle homologues of folded proteins that simpler scoring techniques (such those used in BLAST algorithms) would miss. I am only looking at a small ...
1
vote
1answer
2k views

What's the difference between stabilizing selection and balancing selection?

I came across these terms in Darwin's "Origin of Species" and I wasn't sure what the difference is.
1
vote
1answer
90 views

Why do eyes water in response to particular emotions?

It is common for people to experience very moving situations (sad movies, etc) and have a physical reaction to it (such as crying). I am curious about how emotions can physically lead to the act of ...
1
vote
0answers
38 views

Why does death exist? [duplicate]

The biological purpose of an organism is to reproduce and as soon as reproductive age is passed, aging kicks in and eventually leads to death. (This is what I learned from a gerontologist.) But then, ...
0
votes
0answers
39 views

What is the gene regulation behind human adaptation to higher altitudes and therefore higher hemoglobin levels?

Some people in the Amazonian forest and in Himalayan mountains have reported living perfectly with extremely high levels of hemoglobin. I was wondering what type of gene regulation goes on in order ...
1
vote
1answer
59 views

What is topological crossover?

I read about "topological crossover?" in this paper 1, Table 1. What does this refer to? Thanks
2
votes
1answer
84 views

Why is the resting potential of a neuron so close to the equilibrium potential of K⁺?

I know this has something to do with the K+ leak channel. I just don't understand how. I know that 3 Na+ are pumped out for every 2 K+ pumped in. This makes the cell interior net negative. I know ...
0
votes
1answer
56 views

How to decide if genes are linked in an unordered mapping problem?

From what I understand, if the tetrads resulting from a cross exhibit the same number of parental ditypes as there are nonparental ditypes, then the genes under consideration are said to be unlinked. ...
11
votes
1answer
709 views

Average dimensions of the human back (anthropometry)

I am wondering if anyone can point me to (a scientific source that provides) the estimates of the dimensions (length x width) of the human back? I am specifically interested in the dimensions ...
2
votes
2answers
4k views

Why is it that heterozygous loci appear as two separate bands during gel electrophoresis while homozygous loci appear as one band?

Is it because heterozygotes have a greater base pair length? (And if they do, why is that?) Or is it because recessive alleles are moving slower than the dominant alleles in the gel?
5
votes
1answer
396 views

How can heart disease cause dizziness after eating?

I have been reading several articles explaining dizziness after eating (see here and here), and both articles gloss over something that I found pretty remarkable. Both articles claim that "heart ...
4
votes
0answers
68 views

Why aren't circadian rhythms exactly 24 hours long?

Most organisms exhibit circadian rhythms that have a periodicity of about, but not exactly 24 hours. Why is this? And to what extent can variation in periodicity in circadian rhythms among the ...
1
vote
1answer
55 views

Are there U-rich transcriptional pause sites?

I've heard a statement in a talk that U-rich sequences cause transcriptional pausing. The intuitive explanation for this was that the UTP concentration is lower in the cell than the ATP concentration. ...
1
vote
0answers
20 views

How to engineer chromosomal duplications?

Specific genetic engineering of chromosomal aberrations like deletions, inversions and translocations are doable by using the CRISPR/Cas system or the other programmable nuclease systems. Insertions ...
8
votes
2answers
1k views

What is it about the housekeeping genes that makes them almost immune to gene regulation?

When it comes to eukaryotes, including ourselves, we have all different kinds of specialized cells and tissues that are so different, yet originally all came from the same single cell. And apparently ...
7
votes
1answer
293 views

What evolutionary advantages are provided by ovoviviparity?

I read that some sharks are ovoviviparous. What advantages and disadvantages are provided by this type of reproduction as opposed to egg laying and live birth?
8
votes
2answers
65 views

All UniprotIDs of a cancer pathway

I need to download all uniprotIDs of a cancer pathway, say the AKT Signaling. It may be super easy, but I don't know which resource to look at since it is a new field. How/where do I find these?
6
votes
3answers
325 views

Why are the fertility rates of large predators kept low?

Predators at the top of a food chain, like lions, seem to have a relatively low fertility rate, which fits well to the ecosystem and avoids overpredation. But what is the mechanism that keeps the ...
-3
votes
1answer
98 views

Human Species of Males/Females [closed]

Why is it that when there is discussion about Race/Subspecies it is never about the genetic/physical differences between males and females. So every argument has been about physical and geographic ...
5
votes
1answer
123 views

How do biologists infer correct ORF of a DNA sequence?

Each DNA (RNA) sequence has 6 possible Open Reading Frames(ORF). My question is: What are the theoretical bases of in vitro or in silico tries to find correct reading frame of a sequence? Is it just ...
4
votes
1answer
184 views

What do “e” “-” “C” and “E” mean in this output?

I have given an input of this protein sequence: MEPVDPRLEPWKHPGSQPKTACTTCYCKKCCFHCQVCFTTKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQPRGDPTGPKE from this website along ...
9
votes
1answer
4k views

What senses are active while sleeping?

During sleep, our body activity decreases. I am wondering on the extent of the lowering of this activity regarding our five senses. Clearly, the sense of touch is still very efficient since shaking a ...
3
votes
1answer
139 views

How do cats survive falling from great heights?

Among mammals, cats are able to land safely when falling from great heights. For example, when compared to dogs or humans they can survive drops from relative large heights. How do they manage? A ...
3
votes
0answers
78 views

Is there a standard formula/calculation for sexual dimorphism?

Is there a standard, or most accepted, way to present a value for sexual dimorphism? For example, one could use $$\frac{\text{Female value}}{\text{Male value}} -1$$ This would give negative values ...
3
votes
1answer
71 views

How does beta branching stop alpha helices from forming?

I am told that beta branching interferes with alpha helix formation. Problem is that I don't see how beta branching has anything to do with alpha-helix formation. Beta-branches are on the outside of ...
1
vote
0answers
143 views

First documented beneficial mutation?

I've been reading up on beneficial mutations, and am curious when we discovered and documented the first one. Can anyone point me to the first documented beneficial mutation? Per request, let me ...

15 30 50 per page