1
$\begingroup$

What lineages of the coronavirus SARS-CoV-2 occurring in the wild show some extensions, i.e., mutations of the stop codons to codons encoding amino acids (mutations to another stop codon don't count here).

By chance I found that the pango lineage B.1.1.318 has an extension of the accessory protein encoded by ORF7b.

Are there more such cases, and what lineages are affected?

$\endgroup$
1
  • 2
    $\begingroup$ Due to a 15nt deletion around the ORF7b stop codon B.1.1.318 has a merge of ORF7b and ORF8 giving ORF8: MKF 1:3 MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHAY $\endgroup$
    – reuns
    Sep 24 at 19:43

Your Answer

By clicking “Post Your Answer”, you agree to our terms of service, privacy policy and cookie policy

Browse other questions tagged or ask your own question.