Stack Exchange Network

Stack Exchange network consists of 175 Q&A communities including Stack Overflow, the largest, most trusted online community for developers to learn, share their knowledge, and build their careers.

Visit Stack Exchange

Questions tagged [bioinformatics]

The science of collecting and analyzing complex biological data such as genetic codes using informatics.

1
vote
1answer
35 views

How many palindromic sequences in human genome?

I'm writing an article on palindromes (the words) and I wanted to mention the existence of palindromic gene sequences. Roughly how many palindromes exist in the human genome? I understand the number ...
2
votes
1answer
32 views

Meaning of PAM matrix values

If PAM-1 matrix refers to time or evolutionary event for 1% change in amino acid sequence of a protein then how come there is PAM250? shouldn't PAM 100 be the highest where the two concerned sequences ...
-3
votes
0answers
17 views

how do you get a primer for unknown DNA in sanger method? [closed]

how do you get a primer for an unknown dna in sanger method
0
votes
0answers
19 views

Is there a consensus on the best Machine Learning model for Antimicrobial Resistance (AMR) prediction?

Prediction of bacterial resistance/susceptibility to antimicrobials (from genotypic data) using Machine Learning methods is a problem that has started receiving interest in recent years. The ...
0
votes
1answer
16 views

Is it PSI-BLAST or BLASTP if I use PSI-BLAST for only one iteration

In my case, I used PSI-BLAST in the local BLAST+ to search queries against the self created database. After the first search, I added the searched result to the database and then conducted the ...
-1
votes
0answers
11 views

PSI-BLAST search result, what can you describe about a protein, especially about their possible functions [on hold]

I looked up this protein on psi blast MNNLLKIYSDSNDTKLKLVKEGIEEQGICYEILSLKSAYNLDIKKHPFSLAIIIDNKDILIKSINFIKRI NFNVENISNKYLKEVGLDIGRYIKGFPLKGDW and I did iteration 3. But I don't know how to describe ...
2
votes
0answers
28 views

Why do BRAF mutations appear more in skin cutaneous melanoma?

When looking at the tissue expression of the BRAF protein it seems that BRAF is regularly expressed in almost all of the tissues. There is elevated expression in tissues like the Testis and the ...
0
votes
0answers
27 views

Frequency of nucleotide sequences of specific length in DNA

How frequently would you find the nucleotide sequence GGATATCCGC (5' to 3' direction) by chance in a DNA molecule? On average, how many times do you expect to find a specific 20 nucleotide sequence in ...
1
vote
1answer
33 views

How many proteins on PDB have unknown function?

I was wondering how many of the files in the Protein Data Bank (PDB) have unknown function. The only paper I can find from an internet search is this one from 2012, which I assume might be outdated. I’...
3
votes
1answer
98 views

How to interpret this PubChem record of L-Alanine

Using the PUG service from NCBI, I am retrieving 3d structure data for a molecule. Raw data here. I am trying to understand this record, specifically for the purpose of rendering in a 3D coordinate ...
1
vote
1answer
30 views

From refseq ids to Go term Ids

I have a list of Refseq accession numbers such as : YP_009448812 YP_009448725 YP_009448701 NP_659591 around 10 000 acc_numbers... and I'm looking for a tools in ...
0
votes
0answers
25 views

How did Smith et al 2004 deal with missing HI [Hemagglutination Inhibition assay] values and HI values <10?

In the scientific paper "Mapping the Antigenic and Genetic Evolution of Influenza Virus's" Supporting Material, Smith et al write about determining antigenic distance Dij. However, I don't understand ...
1
vote
2answers
30 views

GEN file format, SNPs and alleles

I have a few questions I can't seem to get a straight answer to, regarding the .gen file format and also biology in general. The ...
1
vote
0answers
25 views

Projects in DNA Computing [closed]

I am physicist and have recently heard about DNA computing. I want to work in this area. I want your ideas on a "feasible but new project" (maximum time I can put on the project: 6 Months ), I can ...
0
votes
1answer
42 views

Question regarding when it's a homoplasy in a phylogenetic tree

If you have 2 organisms that both come directly from the same common ancestor on a phylogenetic tree, and that common ancestor does not have trait "x", is it possible for both of its direct ...
2
votes
2answers
42 views

Meaning of Phred score - probability of base calling error

I learned that Phred quality scores are logarithmically linked to error probabilities. For example, if Phred assigns a quality score of 10 to a base, the chances that this base is called incorrectly ...
0
votes
0answers
17 views

Data base or computational tool to help predict if two predicted interacting surface proteins are located on separate cells or on the same cell?

Is there any computational method or database with the help of which one could predict if two interacting cell surface proteins are located on separate cells or are located on the same cell surface?
1
vote
0answers
9 views

Is there a measure for degree of reticulation in a phylogenetic network?

When working with phylogenetic networks, how does one talk about reticulate (i.e., web-like) the branches are? Is there a standard measure of this?
0
votes
0answers
43 views

Given a list of cell surface genes, is there a computational possibility to predict their interaction partners on the surface of another cell?

After performing differential expression analyses with the Seurat package on my single cell RNA sequencing data from ILC2s of mouse origin, I generated a list of differentially genes. I afterwards ...
3
votes
2answers
128 views

Does the brain have a clock and can it be sped up?

Before i start, I'm an engineer and have very limited knowledge on biology and neuroscience. My question is, does the brain have a clock like a computer where it has a set processing speed? Clocks in ...
0
votes
0answers
14 views

What software is good for the Y STR data processing?

What software is good for the Y STR data processing? I have Arlequin, Structure, GeneLand and Cervus. What is a better choice for the data processing of haploid Y STR data for the estimation of a ...
0
votes
0answers
8 views

What parameters of a blast file are appropriate to detect the real positives

I am analyzing the NGS results. I don't know what parameters of a Blast file I should choose to filter the positives: ...
0
votes
1answer
28 views

Amino acid substitutions near the receptor binding site HA protein in type A H3N2 influenza strains?

I have read the scientific paper, "Substitutions Near the Receptor Binding Site Determine Major Antigenic Change During Influenza Virus Evolution" by Björn F. Koel et al (http://science.sciencemag.org/...
1
vote
1answer
45 views

What does it mean by “end effects can be ignored”

I have been reading a book ( Statistics for Biology and Health) and i encountered many of following bold text. Consider a long DNA sequence of length N, where N is assumed to be so large that end ...
2
votes
1answer
55 views

Gene vs Protein homology

I am trying to find homologs for some proteins and I am wondering if it is better to find it by comparing the proteins or the coding genes or either is fine.
0
votes
1answer
31 views

Observed to Expected CpG

Observed to Expected CpG is calculated as below : Obs/Exp CpG = Number of CpG * N / (Number of C * Number of G) where N = length of sequence. I also don't ...
2
votes
0answers
78 views

Are evolutionary algorithms calculated in polynomial time? [closed]

How complex are evolutionary algorithms? Also, what is the relationship between variational principles (Lagrangians, minima and maxima,) and evolutionary algorithms? Basically, how hard is it right ...
2
votes
3answers
118 views

Strand representation in the DNA version of the Genetic Code

A Wikipedia entry entitled DNA Codon Table states that the codons presented in the table are on the ‘sense strand of the DNA’. But what is the purpose of this, if the sense strand doesn’t code for ...
1
vote
1answer
25 views

How does one predict how large of an effect on antigenic drift a substitution in the amino acid sequence of a surface protein of influenza has?

I know that some amino acid substitutions are more effective in causing antigenic drift than other substitutions based on their location in the 3d structure of the HA protein (proximity to the ...
2
votes
0answers
25 views

Brownian motion : Understanding the output of mvBM function.?

To fit the brownian motion for independent evolution of traits i used below code: ...
0
votes
1answer
42 views

GC content of a protein-coding region

I have computer science background and I am trying to understand the equation below. The average value of the G + C content of a protein-coding region is given by : (G+C)= $\sum_{\alpha} (I_\alpha *...
3
votes
2answers
54 views

Difference between NCBI's /genomes and /1000genomes

Wondering what the difference is in the data hosted here: ftp://ftp-trace.ncbi.nih.gov/1000genomes ftp://ftp.ncbi.nih.gov/genomes/ Also (sidenote), would be interested to note what the difference ...
0
votes
1answer
311 views

Programming Languages for Bioinformatics [duplicate]

Good day everyone, I am very much interested in math, biology, and programming; ideally I would like to study bioinformatics and, as such, was wondering what languages are typically used by ...
0
votes
1answer
27 views

Can I simulate a previous and next sequence of my fasta files?

I have fasta sequences of a virus protein that had suffered a mutation in 2008 and this mutant had increase it fitness when compared to wild strain (according to literature).I want to simulate if my ...
3
votes
2answers
150 views

How are cell death like apoptosis and entropy related?

In Perspectives on Statistical Thermodynamics, Yoshitsugu Oono, it is written that Do not conclude, however, that since the second law is invincible, information thermodynamics is unimportant. It ...
1
vote
1answer
35 views

How to set the phenotype in GWAS analysis?

In the GWAS analysis, my animal sample phenotype is whether an individual dies or survives. And I have every sample death time. How do I set the phenotype in GWAS analysis?
0
votes
2answers
40 views

identification of differentially expressed genes in RNA-seq analysis [on hold]

I am using four different packages (viz. EBSeq, DESeq2, edgeR, LPEseq) for identification of differential genes. Now I am confused whose fold change value should I take for further downstream ...
0
votes
3answers
50 views

why and how multi allele gets reported during variant calling in vcf?

This might be a very basic question for many here. With the basic understanding of inheritance, eventhough there is a possibility of multiple genotypes due to multi alleles, the resulting genotype can ...
0
votes
1answer
54 views

What do these novel splicing sites mean?

I'm sure that the anwser is obvious for some of you but I just endend my internship where we found novel splice junctions (junctionseq; RNAseq data) (see the attached file) and I have some ...
3
votes
1answer
30 views

Best data repository to publish a large 'plotly' table containing all annotations on a transcriptome?

I want to publish a transcriptome paper, along with interactive materials enabling readers to peruse the data behind the discussion. The R package 'plotly' enables rendering online-publishable tables ...
0
votes
1answer
42 views

How does collaboration on reconstructing metabolic networks work?

I am a researcher in psychology and I am trying to come up with a framework/platform in which psychological phenomena can be studied from a dynamical systems / computational perspective in ...
1
vote
1answer
91 views

Giga base or Giga byte [closed]

"we reported ~2.66- Gb genome sequence of" "we generated 191.5 Gb high quality reads" I am very confused with these two quoted lines and I am not sure about giga byte or giga base pair. and an ...
3
votes
2answers
151 views

Can two proteins sharing a few domains be considered homologous?

I wonder when to say two proteins are homolog. In the current example I checked the sequence of these two proteins in pfam and as you see they have some shared domains but all domains are not shared. ...
1
vote
1answer
47 views

Consensus symbols in multiple sequence alignment [closed]

I was using multAlin for multiple aligning a set of sequences. The output I and came across included the following documentation (English corrected): Consensus symbols: ! is any of IV $ is any ...
1
vote
0answers
33 views

What can I research for thesis on DNA data storage from math? [closed]

I'm a math researcher, I just finished a Master on Error Correcting Codes. I recently saw a presentation on DNA-based data storage that I loved. I wish to continue my studies on (applied mathematics) ...
3
votes
3answers
81 views

Biological validation of computationally determined gene-gene interaction

How can a computationally determined three-way gene interaction be biologically validated? What kind of assays or tests must be performed using cell/tissue-based and/or mouse models to prove that the ...
0
votes
0answers
30 views

How to calculate the Marker Index(MI) for a dominant marker such as RAPD and ISSR?

I am working in the genetic diversity analysis of a plant species and have used RAPD and ISSR markers. After scoring the data in a binary matrix, I am trying to find the marker index of the primers. I ...
0
votes
1answer
38 views

Is it possible to re-align of SAM/BAM files?

I am carrying out some metagenomic comparison using whole genome sequencing approach. I would like to filter out reads from my files in a sequential manner, thus I would like to align to a first ...
-1
votes
0answers
38 views

Use of eigenvalues of Sturm-Liuville operator

I am wondering what would be application in biology where bounds on the Eigenvalues of Sturm-Linville operator would be important?
1
vote
0answers
18 views

Is there any data to explore the heterozygosity of the South African lion over the last 18 years?

Background: I need to find data on the heterozygosity of the south African lion over the last 18 years... and I'm struggling: so far I have found a single data point. Question: Where can I find ...