Questions tagged [database]

Questions pertaining to organized collections of biological data.

Filter by
Sorted by
Tagged with
4
votes
3answers
166 views

Identifiying a conserved residue in multiple PDB structures

I have a few hundred PDB structures of the same protein, and I need to identify a specific conserved residue in all of them. Originally I wanted to extract the sequences from the PDB files with ...
1
vote
1answer
43 views

what is the principle behind Allele Frequency Net Database

I just wanted to know what is the basic principle of Allele*Frequency Net Database. How are the frequencies present in them calculated??
1
vote
1answer
116 views

How can I find the most studied SNP of a gene?

How can I find the most studied SNP of a gene and diseases that the most studied SNP has been related to? I search in dbSNP database but I can't find it. What is the process?
2
votes
1answer
2k views

how to change format of ent file into PDB format?

whenever i download files from Protein Data Bank(PDB),they are downloaded in .ent format. How can i convert them into PDB format??
8
votes
3answers
4k views

Where can you find the quantities of each amino acid of a particular protein or food?

Taking a potato as an example. If I wanted to know how much µg or % of each of it's amino acids there are in 1 gram of pure potato protein, where can I find this information? Is there a freely ...
1
vote
1answer
50 views

Why does uniprot sometimes not label single-pass transmembrane proteins as “anchors”?

Currently, section 3a) of unitprot TRANSMEM reference page divides single-pass transmembrane proteins into 4 types: ...
1
vote
0answers
102 views

How to find name of the gene

Considering the kegg page, this page contains the description of the gene Edwardsiella tarda EIB202: ETAE_0074 . Now this gene has a name given in the page as : wabG. Now considering another gene 1 ...
9
votes
1answer
547 views

How can I find the mRNA sequence for a specific prokaryotic gene?

What I want to find out is the start of the transcription for a specific gene, how long the UTR is before the actual coding sequence starts. I've looked at various databases like NCBI Gene, Refseq or ...
2
votes
1answer
68 views

What does uniprot consider “unambiguous” evidence for the subcellular domain of a protein?

Uniprot has annotation for subcellular location of protein domains. This topological domain information of proteins is under the TOPO_DOM flag. In most cases the ...
5
votes
3answers
230 views

Is there a database providing information about optimum temperature and inactive temperature of enzymes?

I want to know optimum and inactive temperature of some enzyme, but I can't find these information in NCBI, wiki or UniProt. So I want to know if there are some database which provide these ...
5
votes
2answers
105 views

Is there a web tool for species identification?

I know this stack exchange provides the ability to post photographs of animals/plants for species identification, but is there a web resource that can automatically identify a plant/animal using image ...
2
votes
0answers
74 views

Genotype-Phenotype databases?

Beyond the Stanford HIV database, what other databases out there provide a dataset linking virus/bacterial genotype to quantitative phenotype? I'm looking for high quality datasets to test machine ...
5
votes
2answers
2k views

Is there a database of cell images?

We're working on an algorithm for processing images of cells, similar to but much more basic than Cell Profiler, and we are looking for a large database of cell images to test our software. Can anyone ...
5
votes
3answers
1k views

Open database of medical images

Does anyone know of an open repository of medical images (e.g., CT scans) organized by disease category? I'm working on some computer vision software that requires a large set of controls from which ...
0
votes
0answers
26 views

Size of the glycan chain in a glycosylated protein

I would like to know where I can find the (experimental/estimated) distribution of glycan sizes attached to proteins.
0
votes
0answers
907 views

Online Database for PPG (Photoplethysmography) signals (both Infrared and Red light readings)

I am looking for an online Database for PPG (Photoplethysmography) signals for SPO2 (oximetry) analysis. I have tried several sources but they only have single datasets labelled "PLETH" and not ...
2
votes
1answer
57 views

Finding a reaction from a KEGG map

I have come across a map and a part of it looks like this: Now I have not been able to locate the reaction that converts alpha D-Glucose to Glucono-1,5-lactone but was successfully able to locate ...
9
votes
2answers
479 views

Database of Geographic Range of Species

Is there a database of organisms which would contain their queriable geographic location? I would need to perform a rather simple query, such as ...
14
votes
2answers
1k views

Why and how does uniprot list around 150,000 proteins in the human genome?

Using organism:"Homo sapiens (Human) [9606]" as a query in uniprot returns about 146,000 proteins. I was under the impression that there were only 20-25,000 protein ...
0
votes
1answer
47 views

Presence of reaction module in bacteria but not in Eukaryotas (human)

From the statistics page, I found that the Module-M00008 is present only in bacteria and not Eukaryotes. Why so? I noticed that all the compounds necessary or the reaction are present in human body ...
2
votes
1answer
39 views

Why is there a compound highlighted in red in a KEGG Module search?

Considering the following module: http://www.kegg.jp/kegg-bin/show_module?M00115+C00003 why is the compound C00003 marked in red?
1
vote
1answer
30 views

What information does the KEGG Module statistics page show?

While browsing through the home page of KEGG Module, I clicked the button named Module statistics. Can someone tell me what does these numbers signify? What are they the statistics of?
1
vote
2answers
439 views

Difference between modules in KEGG Module

The KEGG module M00115 includes a set of reactions while M00542 does not have any; it just shows the list of enzymes. Is the reaction set for M00542 still unknown?
7
votes
2answers
785 views

How to gather life-history traits data on bird species?

I am looking for a data base of life history traits for bird species. Is there such data base? If not, what are your advice on how to collect those data? Is there a handy website that list ...
2
votes
2answers
81 views

Database of medically validated SNPs

I'm looking for all possible sources of clinically tested human SNPs. There is a handful of databases that store SNPs (like dbSNP), but I only need those that have validated presence/absence of ...
7
votes
1answer
998 views

Is there a karyotype database for human cell lines?

I'm looking for the karyotype of a specific cell line. Some karyotypes are well known, such as HeLa or some carcinomas, but some are very hard to find, such as LG2 (B cells). Is there a database ...
-3
votes
1answer
100 views

From where can I download the database created by Hsu et al for MORFs? [closed]

I am working on an independent research project for which I require access to the MORF database created by Hsu et al. From where can I download the database of MORFs of IDPs and their binding partners ...
6
votes
1answer
74 views

How to seek for available genetic data relevant to ecology and evolution?

I had a quick look online. There seems to exist many different website of database archiving. Some data might be free of charge while some others might not be. I found things such as Dryad, TreeBase, ...
1
vote
1answer
112 views

Human population growth - where can I find the data?

Out of curiosity, I'd like play around with data of human global demography. Where can I find data that describe the "per region (per continent for example) population size" versus time since the "...
0
votes
1answer
350 views

Finding Rna-Seq dataset for C. Elegans (Caenorhabditis elegans)

I want to find a RNA-Seq dataset for C. Elegans to use it in RNA-Skim software. For those who does not know RNA-Skim let me explain it a bit. It is a tool which is used to quantify RNA-Seq data using ...
3
votes
1answer
297 views

Resources of all known biochemical pathways?

I am looking for a encyclopedia or biochemical pathway atlas of all known or reported pathways. I am very much interested in network and systems biology. Also the references can be open databases, ...
4
votes
1answer
2k views

What is the difference between “physical interaction” and “genetic interaction”?

I searched sac1 in uniprot to know more about this gene. in interaction I selected this link and there I see that this gene has some "physical interactions" and "genetic interactions". I am wondering ...
0
votes
2answers
487 views

Difficulties understanding a pathway [closed]

I am not a biologist and I would love to understand what is going on with this pathway. I went to the description but it's still complicated, and I couldn't follow. Can someone please help me with it? ...
3
votes
0answers
335 views

Is there a database of known riboswitches?

I'm looking for sequences and annotations of known riboswitches, but so far I haven't found a resource that actually fulfills my requirements. The best database I found so far is Rfam, which has ...
5
votes
2answers
555 views

Where can I find mutation datasets for cancer?

My lab has been using TCGA data (somatic mutations and clinical data) to develop panels of genes and of mutations we expect to see in certain cancer populations. We'd like to validate our panels by ...
5
votes
1answer
625 views

What do “e” “-” “C” and “E” mean in this output?

I have given an input of this protein sequence: MEPVDPRLEPWKHPGSQPKTACTTCYCKKCCFHCQVCFTTKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQPRGDPTGPKE from this website along ...
1
vote
0answers
80 views

Download FunCat Database for Programmatic Access

I am enriching RNA-seq data for the fungus Neurospora crassa and would like to be able to search the genome by functional category, determine similarity of genes by category membership, and any other ...
2
votes
2answers
119 views

Downloading specific yeast genes in an automated manner?

I have 6 genes of Candida albicans yeast namely orf19.723, orf19.5908, orf19.610, ...
4
votes
4answers
211 views

Where should I start looking for an online gene library?

Is there an online library that includes all known genes in stored in their nucleotide form of all living organisms? I'm presuming that such a database doesn't exist. So to kick of my search, how ...
1
vote
2answers
56 views

Resource for finding what proteins bind?

I have two lists of proteins (including phosphorylated forms). I want to determine which members of each list act on which members of the other list. What online resources exist for finding out what a ...
1
vote
0answers
58 views

Recombination frequency as a function of genomic location in E coli?

Are there any databases or papers that give recombination frequency as a function of position in the E coli genome?
1
vote
2answers
3k views

What are the rules for plasmid names?

What are best practices for naming newly created plasmids? For example, a common format is pABC123. What is the exact specification? Must there be 3 letters? What ...
1
vote
1answer
72 views

Any databases with AAMI ECG and ECHO?

There is no AAMI 12-lead ECG databases available online. All of them have problems. I and my friends finally finalised our tests with St Petersburg. It is not AAMI. So the next step is to search ...
6
votes
3answers
150 views

What is a good source that will help me classify protists?

I am a 15 year old that enjoys looking at the micro world. The only issue that I have is that I can't find a good online source that will help me classify the name of the micro organism that I'm ...
1
vote
1answer
47 views

programmatic fast search of 100-1000 short reads to a public server and obtain list of nearby genes

What are the options for programmatic fast searching of 100-1000 short reads to a public server and obtain list of nearby genes where the reads map? Input: ~100-1000 short reads Output: GFF list of ...
1
vote
1answer
389 views

Dataset of microscopic images before and after staining?

I am looking for a freely distributed dataset of microscopic images. I am hoping to find a dataset that would feature histological images before and after staining (e.g. H&E or some other standard ...
5
votes
2answers
269 views

Database of Multicellular and Unicellular organisms?

I'm trying to annotate a list of organisms taken from NCBI for cellularity (unicellular or multicellular). Does any of you ever found a database with association between an organisms' name or taxa and ...
0
votes
2answers
1k views

Convert gene name to uniprot ID

I have a list of gene name in a file CHRNB2 EGR2 GCK KRT14 LMNA FGF3 TK2 ABCC8 How can I map them to uniprot ID ? P.S I tried Uniprot "ID mapping" (from-"...
2
votes
0answers
129 views

dbSNP database table desciptions

I am trying to build a local implementation of dbSNP. I would like to know the descriptions of tables listed on ftp://ftp.ncbi.nlm.nih.gov/snp/database/organism_data/human_9606 and on ftp://ftp.ncbi....
4
votes
1answer
611 views

Local storage of NCBI database in MongoDB [closed]

My short term goal in a project is to build a local database of the NCBI dbSNP database. The data and schema are available on the FTP site(). I was going to implement the database using MySQL, but I ...